General Information

  • ID:  hor000796
  • Uniprot ID:  D8KXX3
  • Protein name:  Corazonin
  • Gene name:  NA
  • Organism:  Daphnia pulex (Water flea)
  • Family:  Corazonin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Daphnia (genus), Daphniidae (family), Anomopoda (infraorder), Cladocera (suborder), Diplostraca (order), Phyllopoda (subclass), Branchiopoda (class), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0071858 corazonin receptor binding
  • GO BP:  GO:0045823 positive regulation of heart contraction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QTFQYSRGWTN
  • Length:  11(33-43)
  • Propeptide:  MFINQYVRYSSSIAMAVRLYFVLLLVVVSAMAQTFQYSRGWTNGRKRSDPSFVQQQQWIQRNGHPIVVPAEFRSNSFEDWSRYRINSEKVFLIVCSCVTFSKRDFMLISVGCHDDNR
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-D8KXX3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000796_AF2.pdbhor000796_ESM.pdb

Physical Information

Mass: 156601 Formula: C62H86N18O19
Absent amino acids: ACDEHIKLMPV Common amino acids: QT
pI: 9.35 Basic residues: 1
Polar residues: 6 Hydrophobic residues: 2
Hydrophobicity: -154.55 Boman Index: -3507
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 0
Instability Index: 713.64 Extinction Coefficient cystines: 6990
Absorbance 280nm: 699

Literature

  • PubMed ID:  21830762
  • Title:  Genomics, Transcriptomics, and Peptidomics of Daphnia Pulex Neuropeptides and Protein Hormones